Abnova Corporation

Designed for the clinical and in vitro diagnostic industries, Abnova products are manufactured in an ISO13485 and GMP-certified facility and an ISO15189 medical laboratory. They include rabbit monoclonal antibodies, ELISA kits, FISH probes, and CytoQuest™ CR systems.

Narrow Results

special interests

Fast Shipping (3)

Classification

Cocktail (3)
Low Endotoxin/Azide-free (LE/AF) (1)
Monoclonal (29,786)
Monoclonal/Polyclonal (3,638)
Polyclonal (28,695)

Regulatory Status

RUO (56,769)

1 – 15of93,094results

Abnova™ Human TXNL1 (NP_004777, 1 a.a. - 289 a.a.) Full-length Recombinant Protein with His tag

Used for SDS-PAGE

Pricing & Availability

Abnova™ ACVR1 (R206H) (Human) Recombinant Protein

For use with Functional Study.

Pricing & Availability

Abnova™ Human HK2 (NP_000180, 1 a.a. - 917 a.a.) Full-length Recombinant Protein with His tag

Used for Func, SDS-PAGE

Pricing & Availability

Abnova™ Human PIM2 (XM_010208, 1 a.a. - 311 a.a.) Full-length Recombinant Protein with GST-His tag expressed in Sf9 cells

Used for Func, SDS-PAGE

Pricing & Availability

Abnova™ Human PITPNA Partial ORF (NP_006215.1, 171 a.a. - 270 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Pricing & Availability
Specifications

Form	Liquid
Common Name	PITPNA
Molecular Weight (g/mol)	36.74kDa
Gene Symbol	PITPNA
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Expression System	wheat germ expression system
For Use With (Application)	Antibody Production,ELISA,Protein Array,Western Blot
Name	PITPNA (Human) Recombinant Protein (Q01)
Accession Number	NP_006215.1
Regulatory Status	RUO
Gene Alias	MGC99649/PITPN/VIB1A
Gene ID (Entrez)	5306
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Immunogen	GPLGPNWKQELVNQKDCPYMCAYKLVTVKFKWWGLQNKVENFIHKQERRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADD
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Protein Tag	GST
Species	Wheat Germ (in vitro)
Recombinant	Recombinant

Abnova™ Human PKMYT1 Partial ORF (NP_004194.3, 400 a.a. - 499 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Pricing & Availability
Specifications

Form	Liquid
Common Name	PKMYT1
Molecular Weight (g/mol)	36.74kDa
Gene Symbol	PKMYT1
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Expression System	wheat germ expression system
For Use With (Application)	Antibody Production,ELISA,Protein Array,Western Blot
Name	PKMYT1 (Human) Recombinant Protein (Q01)
Accession Number	NP_004194.3
Regulatory Status	RUO
Gene Alias	DKFZp547K1610/FLJ20093/MYT1
Gene ID (Entrez)	9088
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Immunogen	PASWLQPLGPPATPPGSPPCSLLLDSSLSSNWDDDSLGPSLSPEAVLARTVGSTSTPRSRCTPRDALDLSDINSEPPRGSFPSFEPRNLLSLFEDTLDPT
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Protein Tag	GST
Species	Wheat Germ (in vitro)
Recombinant	Recombinant

Abnova™ PIWIL1 293T Cell Transient Overexpression Lysate (Denatured)

Human overexpression lysate

Pricing & Availability

Abnova™ Human PKD2L1 Full-length ORF (AAH25665, 1 a.a. - 805 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Pricing & Availability
Specifications

Form	Liquid
Common Name	PKD2L1
Molecular Weight (g/mol)	114.29kDa
Gene Symbol	PKD2L1
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Expression System	wheat germ expression system
For Use With (Application)	Antibody Production,Protein Array,ELISA,Western Blot
Name	PKD2L1 (Human) Recombinant Protein (P01)
Accession Number	AAH25665
Regulatory Status	RUO
Purification Method	Glutathione Sepharose 4 Fast Flow
Gene Alias	PCL/PKD2L/PKDL
Gene ID (Entrez)	9033
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Immunogen	MNAVGSPEGQELQKLGSGAWDNPAYSGPPSPHGTLRVCTISSTGPLQPQPKKPEDEPQETAYRTQVSSCCLHNCQGIRGLWGTTLTENTAENRELYIKTTLRELLVYIVFLVDICLLTYGMTSSSAYYYTKVMSELFLHTPSDTGVSFQAISSMADFWDFAQGPLLDSLYWTKWYNNQSLGHGSHSFIYYENMLLGVPRLRQLKVRNDSCVVHEDFREDILSCYDVYSPDKEEQLPFGPFNGTAWTYHSQDELGGFSHWGRLTSYSGGGYYLDLPGSRQGSAEALRALQEGLWLDRGTRVVFIDFSVYNANINLFCVLRLVVEFPATGGAIPSWQIRTVKLIRYVSNWDFFIVGCEVIFCVFIFYYVVEEILELHIHRLRYLSSIWNILDLVVILLSIVAVGFHIFRTLEVNRLMGKLLQQPNTYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSSTLARCAKDILGFAVMFFIVFFAYAQLGYLLFGTQVENFSTFIKCIFTQFRIILGDFDYNAIDNANRILGPAYFVTYVFFVFFVLLNMFLAIINDTYSEVKEELAGQKDELQLSDLLKQGYNKTLLRLRLRKERVSDVQKVLQGGEQEIQFEDFTNTLRELGHAEHEITELTATFTKFDRDGNRILDEKEQEKMRQDLEEERVALNTEIEKLGRSIVSSPQGKSGPEAARAGGWVSGEEFYMLTRRVLQLETVLEGVVSQIDAVGSKLKMLERKGWLAPSPGVKEQAIWKHPQPAPAVTPDPWGVQGGQESEVPYKREEEALEERRLSRGEIPTLQRS
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Protein Tag	GST
Species	Wheat Germ (in vitro)
Recombinant	Recombinant

Abnova™ Human PKN2 Partial ORF (NP_006247, 580 a.a. - 679 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Pricing & Availability
Specifications

Form	Liquid
Common Name	PKN2
Molecular Weight (g/mol)	36.63kDa
Gene Symbol	PKN2
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Expression System	wheat germ expression system
For Use With (Application)	Antibody Production,ELISA,Protein Array,Western Blot
Name	PKN2 (Human) Recombinant Protein (Q01)
Accession Number	NP_006247
Regulatory Status	RUO
Gene Alias	MGC150606/MGC71074/PAK2/PRK2/PRKCL2/PRO2042/Pak-2
Gene ID (Entrez)	5586
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Immunogen	RASSLGEIDESSELRVLDIPGQDSETVFDIQNDRNSILPKSQSEYKPDTPQSGLEYSGIQELEDRRSQQRFQFNLQDFRCCAVLGRGHFGKVLLAEYKNT
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Protein Tag	GST
Species	Wheat Germ (in vitro)
Recombinant	Recombinant

Abnova™ PLA2G4D 293T Cell Transient Overexpression Lysate (Denatured) (T02)

Human overexpression lysate

Pricing & Availability

Abnova™ Human PIP5K2B Full-length ORF (AAH27459, 1 a.a. - 281 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Pricing & Availability
Specifications

Form	Liquid
Common Name	PIP4K2B
Molecular Weight (g/mol)	56.65kDa
Gene Symbol	PIP4K2B
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Expression System	wheat germ expression system
For Use With (Application)	Antibody Production,Protein Array,ELISA,Western Blot
Name	PIP5K2B (Human) Recombinant Protein (P01)
Accession Number	AAH27459
Regulatory Status	RUO
Purification Method	Glutathione Sepharose 4 Fast Flow
Gene Alias	PI5P4KB/PIP5K2B/PIP5KIIB/PIP5KIIbeta
Gene ID (Entrez)	8396
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Immunogen	MSSNCTSTTAVAVAPLSASKTKTKKKHFVCQKVKLFRASEPILSVLMWGVNHTINELSNVPVPVMLMPDDFKAYSKIKVDNHLFNKENLPSRFKFKEYCPMVFRNLRERFGIDDQDYQNSVTRSAPINSDSQGRCGTRFLTTYDRRFVIKTVSSEDVAEMHNILKKYHQFIVECHGNTLLPQFLGMYRLTVDGVETYMVVTRNVFSHRLTVHRKYDLKGSTVAREASDKEKAKDLPTFKDNDFLNEGQKLHVGEESKKNFLEKLKRDVEEILVLSPGRRIA
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Protein Tag	GST
Species	Wheat Germ (in vitro)
Recombinant	Recombinant

Abnova™ Human PIP5K3 Partial ORF (NP_689884, 342 a.a. - 451 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Pricing & Availability
Specifications

Form	Liquid
Common Name	PIP5K3
Molecular Weight (g/mol)	37.84kDa
Gene Symbol	PIP5K3
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Expression System	wheat germ expression system
For Use With (Application)	Antibody Production,ELISA,Protein Array,Western Blot
Name	PIP5K3 (Human) Recombinant Protein (Q01)
Accession Number	NP_689884
Regulatory Status	RUO
Gene Alias	CFD/FAB1/KIAA0981/MGC40423/PIKFYVE/PIP5K
Gene ID (Entrez)	200576
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Immunogen	LQSTEFSETPSPDSDSVNSVEGHSEPSWFKDIKFDDSDTEQIAEEGDDNLANSASPSKRTSVSSFQSTVDSDSAASISLNVELDNVNFHIKKPSKYPHVPPHPADQKGRR
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Protein Tag	GST
Species	Wheat Germ (in vitro)
Recombinant	Recombinant

Abnova™ Human PKIB Full-length ORF (NP_115860.1, 1 a.a. - 78 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Pricing & Availability
Specifications

Form	Liquid
Common Name	PKIB
Molecular Weight (g/mol)	34.9kDa
Gene Symbol	PKIB
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Expression System	wheat germ expression system
For Use With (Application)	Antibody Production,Protein Array,ELISA,Western Blot
Name	PKIB (Human) Recombinant Protein (P01)
Accession Number	NP_115860.1
Regulatory Status	RUO
Purification Method	Glutathione Sepharose 4 Fast Flow
Gene Alias	FLJ23817/PRKACN2
Gene ID (Entrez)	5570
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Immunogen	MRTDSSKMTDVESGVANFASSARAGRRNALPDIQSSAATDGTSDLPLKLEALSVKEDAKEKDEKTTQDQLEKPQNEEK
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Protein Tag	GST
Species	Wheat Germ (in vitro)
Recombinant	Recombinant

Abnova™ Human PIN4 Full-length ORF (NP_006214.2, 1 a.a. - 156 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Pricing & Availability
Specifications

Form	Liquid
Common Name	PIN4
Molecular Weight (g/mol)	43kDa
Gene Symbol	PIN4
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Expression System	wheat germ expression system
For Use With (Application)	Antibody Production,Protein Array,ELISA,Western Blot
Name	PIN4 (Human) Recombinant Protein (P01)
Accession Number	NP_006214.2
Regulatory Status	RUO
Purification Method	Glutathione Sepharose 4 Fast Flow
Gene Alias	EPVH/MGC138486/PAR14/PAR17
Gene ID (Entrez)	5303
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Immunogen	MPMAGLLKGLVRQLERFSVQQQASKMPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Protein Tag	GST
Species	Wheat Germ (in vitro)
Recombinant	Recombinant

Abnova™ PIP5K2A 293T Cell Transient Overexpression Lysate (Denatured)

Human overexpression lysate

Pricing & Availability

Prev
1
2
3
4
5
6
...
6,207
Next

Abnova Corporation

Filtered Search Results

Narrow Results