Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Tocris Bioscience™ Parathyroid hormone (1-34) (rat)
Parathyroid hormone (PTH) receptor agonist
Supplier: Tocris Bioscience™ 6301/1
This item is not returnable.
View return policy
Description
Parathyroid hormone (1-34) (rat) is a parathyroid hormone (PTH) receptor agonist. Increases serum PTH levels and bone mass in rats.Specifications
Rat | |
98614-76-7 | |
Biological reactions | |
Protein agonist | |
RUO - research use only |
95% | |
Store at −20°C | |
4057.74g/mol | |
1 mg | |
AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?
Provide Content Correction