tripartite motif-containing 63 (A01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant TRIM63.

Supplier:  Abnova Corporation H00084676A01

Catalog No. 89-004-743

Description

This gene encodes a member of the RING zinc finger protein family found in striated muscle and iris. The product of this gene is localized to the Z-line and M-line lattices of myofibrils, where titin's N-terminal and C-terminal regions respectively bind to the sarcomere. In vitro binding studies have shown that this protein also binds directly to titin near the region of titin containing kinase activity. Another member of this protein family binds to microtubules. Since these family members can form heterodimers, this suggests that these proteins may serve as a link between titin kinase and microtubule-dependent signal pathways in muscle. [provided by RefSeq]

Sequence: DKSTKLVETAIQSLDEPGGATFLLTAKQLIKSIVEASKGCQLGKTEQGFENMDFFTLDLEHIADALRAIDFGTDEEEEEFIEEEDQEEEESTEGKEEGH

Specifications

• Antigen: tripartite motif-containing 63
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant TRIM63.
• Gene: TRIM63
• Gene Alias: FLJ32380/IRF/MURF1/MURF2/RNF28/SMRZ
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Ubiquitin/Proteasome
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_032588
• Gene Symbols: TRIM63
• Immunogen: TRIM63 (NP_115977, 254 a.a. ∼ 352 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 84676
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.