spastic paraplegia 21 (autosomal recessive, Mast syndrome), Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant SPG21.

Supplier:  Abnova Corporation H00051324A01

Catalog No. 89-004-626

Description

The protein encoded by this gene was identified by a two-hybrid screen using CD4 as the bait. It binds to the hydrophobic C-terminal amino acids of CD4 which are involved in repression of T cell activation. The interaction with CD4 is mediated by the noncatalytic alpha/beta hydrolase fold domain of this protein. It is thus proposed that this gene product modulates the stimulatory activity of CD4. At least three different transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq

Sequence: PHKIRDIPVTIMDVFDQSALSTEAKEEMYKLYPNARRAHLKTGGNFPYLCRSAEVNLYVQIHLLQFHGTKYAAIDPSMVSAEELEVQKGSLGISQE

Specifications

• Antigen: spastic paraplegia 21 (autosomal recessive, Mast syndrome)
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant SPG21.
• Gene: SPG21
• Gene Alias: ACP33/BM-019/GL010/MASPARDIN/MAST
• Host Species: Mouse
• Quantity: 50 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 51324
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_016630
• Gene Symbols: SPG21
• Immunogen: SPG21 (NP_057714, 211 a.a. ∼ 306 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum