Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Rho family GTPase 1, Mouse, Polyclonal Antibody, Abnova™

Name: Rho family GTPase 1, Mouse, Polyclonal Antibody, Abnova&trade;
Brand: Abnova Corporation
SKU: 89-004-598
Price: 344.00 USD

Mouse polyclonal antibody raised against a partial recombinant RND1.

Supplier: Abnova Corporation H00027289A01

Catalog No. 89-004-598

$344.00 / Each of 1

Qty

Add to Cart

Description

Members of the Rho GTPase family, such as RND1, regulate the organization of the actin cytoskeleton in response to extracellular growth factors (Nobes et al., 1998 [PubMed 9531558]).[supplied by OMIM

Sequence: LSTLMELSHQKQAPISYEQGCAIAKQLGAEIYLEGSAFTSEKSIHSIFRTASMLCLNKPSPLPQKSPVRSLSKRLLHLPSRSELISSTFKKEKAKSCSIM

Specifications

Antigen	Rho family GTPase 1
Classification	Polyclonal
Description	Mouse polyclonal antibody raised against a partial recombinant RND1.
Gene	RND1
Gene Alias	ARHS/FLJ42294/RHO6/RHOS
Host Species	Mouse
Quantity	50 μL
Research Discipline	Cell Adhesion
Primary or Secondary	Primary
Target Species	Human
Form	Serum

Applications	ELISA
Conjugate	Unconjugated
Formulation	50% glycerol
Gene Accession No.	NM_014470
Gene Symbols	RND1
Immunogen	RND1 (NP_055285, 133 a.a. ∼ 232 a.a) partial recombinant protein with GST tag.
Regulatory Status	RUO
Whole Molecule	Yes
Gene ID (Entrez)	27289
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Product Suggestions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

Full Name:

Email Address:*

User Name:

Telephone Number:

What type of issue did you experience with the content on the page?*

Please provide a detailed description of the issue or request*

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Spot an opportunity for improvement?

Provide Content Correction

Rho family GTPase 1, Mouse, Polyclonal Antibody, Abnova™

Description

Specifications

Product Suggestions

Documents

Promotions