Novus Biologicals
Manufacturer Code:NBP19134520UL
Catalog # NBP19134520
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the middle region of human XYLT1. Peptide sequence RITNWNRKLGCKCQYKHIVDWCGCSPNDFKPQDFHRFQQTARPTFFARKF. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: beta-D-xylosyltransferase 1; beta-D-xylosyltransferase 1 O-xylosyltransferase 1 peptide O-xylosyltransferase 1 PXYLT1 XT1 xylosyltransferase 1 xylosyltransferase I xylT-I; Peptide O-xylosyltransferase 1; XT-I; Xylosyltransferase 1; Xylosyltransferase I; xylosyltransferase iota
Gene Aliases: DBQD2; PXYLT1; XT-I; XT1; XTI; xylT-I; XYLT1; XYLTI
UniProt ID: (Human) Q86Y38
Entrez Gene ID: (Human) 64131
Molecular Function: glycosyltransferase transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.