Novus Biologicals
Manufacturer Code:NBP247338
Catalog # NBP247338
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPE |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Alpha-synuclein; Lewy body) 4 MGC110988 non A-beta component of AD amyloid Non-A beta component of AD amyloid non-A4 component of amyloid Non-A4 component of amyloid precursor PARK4 synuclein alpha (non A4 component of amyloid precursor); NACP; non A-beta component of AD amyloid; Non-A beta component of AD amyloid; Non-A4 component of amyloid precursor; synuclein alpha-140; synuclein, alpha (non A4 component of amyloid precursor)
Gene Aliases: NACP; PARK1; PARK4; PD1; SNCA
UniProt ID: (Human) P37840
Entrez Gene ID: (Human) 6622
Molecular Function:
chaperone
membrane traffic protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.