Novus Biologicals
Manufacturer Code:NBP187368
Catalog # NBP187368
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:MGDPERPEAAGLDQDERSSSDTNESEIKSNEEPLLRKSSRRFV |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 1.17.4.1 MGC102856 MGC42116 MTDPS8A MTDPS8B p53-inducible ribonucleotide reductase small subunit 2 homolog p53-inducible ribonucleotide reductase small subunit 2-like protein p53R2 P53R2DKFZp686M05248 PEOA5 ribonucleoside-diphosphate reductase subunit M2 B ribonucleotide reductase M2 B (TP53 inducible) TP53-inducible ribonucleotide reductase M2 B; p53-inducible ribonucleotide reductase small subunit 2 homolog; p53-inducible ribonucleotide reductase small subunit 2 short form beta; p53-inducible ribonucleotide reductase small subunit 2-like protein; p53R2; Ribonucleoside-diphosphate reductase subunit M2 B; ribonucleotide reductase M2 B (TP53 inducible); TP53-inducible ribonucleotide reductase M2 B
Gene Aliases: MTDPS8A; MTDPS8B; P53R2; RRM2B
UniProt ID: (Human) Q75PQ7
Entrez Gene ID: (Human) 50484
Molecular Function:
oxidoreductase
reductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.