Novus Biologicals
Manufacturer Code:NBP185485
Catalog # NBP185485
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:CVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLT |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: cPGES; cPGESp23 Cytosolic prostaglandin E2 synthase Hsp90 co-chaperone P23cytosolic prostaglandin E synthase Progesterone receptor complex p23 prostaglandin E synthase 3 prostaglandin E synthase 3 (cytosolic) TEBPEC 5.3.99.3 Telomerase-binding protein p23 unactive progesterone receptor 23 kD; cytosolic prostaglandin E synthase; Cytosolic prostaglandin E2 synthase; Hsp90 co-chaperone; Progesterone receptor complex p23; Prostaglandin E synthase 3; prostaglandin E synthase 3 (cytosolic); Telomerase-binding protein p23; unactive progesterone receptor, 23 kD
Gene Aliases: cPGES; P23; PTGES3; TEBP
UniProt ID: (Human) Q15185
Entrez Gene ID: (Human) 10728
Molecular Function:
chaperone
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.