Novus Biologicals
Manufacturer Code:NBP258778
Catalog # NBP258778
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDAR |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CDK inhibitor p19INK4d; CDK inhibitor p19INK4d cell cycle inhibitor Nur77 associating protein cyclin-dependent kinase 4 inhibitor D cyclin-dependent kinase 4 inhibitor D p19 cyclin-dependent kinase inhibitor 2D (p19 inhibits CDK4) inhibitor of cyclin-dependent kinase 4d INK4D p19 p19-INK4D; cell cycle inhibitor, Nur77 associating protein; Cyclin-dependent kinase 4 inhibitor D; cyclin-dependent kinase 4 inhibitor D p19; cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4); inhibitor of cyclin-dependent kinase 4d; p19-INK4d
Gene Aliases: CDKN2D; INK4D; p19; p19-INK4D
UniProt ID: (Human) P55273
Entrez Gene ID: (Human) 1032
Molecular Function:
enzyme modulator
kinase inhibitor
kinase modulator
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.