Novus Biologicals
Manufacturer Code:NBP238566
Catalog # NBP238566
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RQLDDATEANEGLSREVSTLKNRLRRGGPISFSSSRSGRRQLHLEGASLELSDDDTESKTSDVNETQPPQ |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Cellular myosin heavy chain type B cellular myosin heavy chain type B type B heavy polypeptide 10 non-muscle MGC134913 MGC134914 Myosin heavy chain 10 Myosin heavy chain non-muscle IIb myosin heavy chain nonmuscle type B myosin heavy chain 10 non-muscle myosin-10 near to the ATP binding region NMMHC II-b NMMHCB NMMHC-B NMMHC-IIB Non-muscle myosin heavy chain B nonmuscle myosin heavy chain IIB Non-muscle myosin heavy chain IIb nonmuscle myosin heavy chain-B nonmuscle myosin II heavy chain-B; Cellular myosin heavy chain, type B; Myosin heavy chain 10; Myosin heavy chain, non-muscle IIb; myosin heavy chain, nonmuscle type B; myosin, heavy polypeptide 10, non-muscle; Myosin-10; NMMHC II-b; NMMHC-B; Non-muscle myosin heavy chain B; Non-muscle myosin heavy chain IIb; nonmuscle myosin heavy chain IIB; nonmuscle myosin II heavy chain-B
Gene Aliases: MYH10; NMMHC-IIB; NMMHCB
UniProt ID: (Human) P35580
Entrez Gene ID: (Human) 4628
Molecular Function: G-protein modulator actin binding motor protein actin family cytoskeletal protein cell junction protein cytoskeletal protein enzyme modulator
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.