Novus Biologicals
Manufacturer Code:NBP182396
Catalog # NBP182396
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide towards Metabotropic Glutamate Receptor 1. Peptide sequence CGALHVCFITPSFPVDTSNQFVLQLRPELQEALISIIDHYKWQTFVYIYD. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: glutamate receptor metabotropic 1 GRM1A metabotropic glutamate receptor 1 mGluR1 MGLUR1A MGLUR1GPRC1AmGlu1; glutamate receptor, metabotropic 1; Metabotropic glutamate receptor 1; mGluR1; protein phosphatase 1, regulatory subunit 85
Gene Aliases: GPRC1A; GRM1; MGLU1; MGLUR1; PPP1R85; SCAR13
UniProt ID: (Human) Q13255
Entrez Gene ID: (Human) 2911
Molecular Function: G-protein coupled receptor receptor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.