Novus Biologicals
Manufacturer Code:NBP169300
Catalog # NBP169300
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SLC37A1(solute carrier family 37 (glycerol-3-phosphate transporter) member 1) The peptide sequence was selected from the middle region of SLC37A1 (NP_061837). Peptide sequence LKIPGVIEFSLCLLFAKLVSYTFLFWLPLYITNVDHLD |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: FLJ22340 G-3-P permease G-3-P transporter G3PPgene similar to glycerol-3-phosphate permease10Glycerol-3-phosphate permease glycerol-3-phosphate transporter solute carrier family 37 (glycerol-3-phosphate transporter) member 1 Solute carrier family 37 member 1; G-3-P permease; G-3-P transporter; Glucose-6-phosphate exchanger SLC37A1; Glycerol-3-phosphate permease; glycerol-3-phosphate transporter; solute carrier family 37 (glucose-6-phosphate transporter), member 1; solute carrier family 37 (glycerol-3-phosphate transporter), member 1; Solute carrier family 37 member 1
Gene Aliases: G3PP; SLC37A1
UniProt ID: (Human) P57057
Entrez Gene ID: (Human) 54020
Molecular Function: cation transporter transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.