Novus Biologicals
Manufacturer Code:NBP157565
Catalog # NBP157565
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ETF1 (eukaryotic translation termination factor 1) The peptide sequence was selected from the N terminal of ETF1)(50ug). Peptide sequence ISLIIPPKDQISRVAKMLADEFGTASNIKSRVNRLSVLGAITSVQQRLKL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: D5S1995 ERF1eRF1 eukaryotic peptide chain release factor subunit 1 Eukaryotic release factor 1 eukaryotic translation termination factor 1 polypeptide chain release factor 1 Protein Cl1 RF1ERF sup45 (yeast omnipotent suppressor 45) homolog-like 1 SUP45L1 TB3-1MGC111066; Eukaryotic peptide chain release factor subunit 1; Eukaryotic release factor 1; polypeptide chain release factor 1; Protein Cl1; sup45 (yeast omnipotent suppressor 45) homolog-like 1; TB3-1
Gene Aliases: D5S1995; ERF; ERF1; ETF1; RF1; SUP45L1; TB3-1
UniProt ID: (Human) D3DQC1
Entrez Gene ID: (Human) 2107
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.