Novus Biologicals
Manufacturer Code:NBP256755
Catalog # NBP256755
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SKMVPTSDKGRFYAFGRVFSGLVSTGLKVRIMGPNYTPGKKEDLYLKPIQRTILMMGRYVEPIEDVPCGNIVGLVGVDQFLVKTGTITTFEHAHNMRVMKFSVSPV |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EF-2; EF-2 EF2EEF-2 elongation factor 2 eukaryotic translation elongation factor 2 polypeptidyl-tRNA translocase; Elongation factor 2; polypeptidyl-tRNA translocase
Gene Aliases: EEF-2; EEF2; EF-2; EF2; SCA26
UniProt ID: (Human) P13639
Entrez Gene ID: (Human) 1938
Molecular Function:
G-protein
RNA binding protein
enzyme modulator
hydrolase
nucleic acid binding
translation elongation factor
translation factor
translation initiation factor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.