Novus Biologicals
Manufacturer Code:NBP169142
Catalog # NBP169142
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to CLRN1 (clarin 1) The peptide sequence was selected from the C terminal of CLRN1. Peptide sequence QSEKYTTSFWVIFFCFFVHFLNGLLIRLAGFQFPFAKSKDAETTNVAADL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: clarin 1 clarin-1 USH3 USH3AUsher syndrome type-3 protein Usher syndrome 3A; Clarin-1; Usher syndrome type-3 protein
Gene Aliases: CLRN1; RP61; USH3; USH3A
UniProt ID: (Human) P58418
Entrez Gene ID: (Human) 7401
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.