Novus Biologicals
Manufacturer Code:NBP180306
Catalog # NBP180306
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the N terminal of human MYB. Peptide sequence YDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTD. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: c-myb Cmyb c-myb protein (140 AA) c-myb_CDS c-myb10A_CDS c-myb13A_CDS c-myb14A_CDS c-myb8B_CDS efg Proto-oncogene c-Myb transcriptional activator Myb v-myb avian myeloblastosis viral oncogene homolog v-myb myeloblastosis viral oncogene homolog (avian); oncogene AMV; Proto-oncogene c-Myb; Transcriptional activator Myb; v-myb avian myeloblastosis viral oncogene homolog
Gene Aliases: c-myb; c-myb_CDS; Cmyb; efg; MYB
UniProt ID: (Human) P10242
Entrez Gene ID: (Human) 4602
Molecular Function:
DNA binding protein
nucleic acid binding
transcription factor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.