Novus Biologicals
Manufacturer Code:NBP179278
Catalog # NBP179278
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the middle region of human ARRB2. Peptide sequence RLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
For Research Use Only
Protein Aliases: ARB2 ARR2 arrestin 3 Arrestin beta-2 arrestin beta 2 BARR2 beta-arrestin-2 DKFZp686L0365; arrestin 3; Arrestin beta-2; arrestin, beta 2; Beta-arrestin-2; Non-visual arrestin-3
Gene Aliases: ARB2; ARR2; ARRB2; BARR2
UniProt ID: (Human) P32121
Entrez Gene ID: (Human) 409
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.