Novus Biologicals
Manufacturer Code:NBP159837
Catalog # NBP159837
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to B4GALT2 (UDP-Gal:betaGlcNAc beta 14- galactosyltransferase polypeptide 2) The peptide sequence was selected from the middle region of B4GALT2. Peptide sequence AGYFGGVSGLSKAQFLRINGFPNEYWGWGGEDDDIFNRISL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: B4Gal-T2 B4Gal-T3 beta-14-galactosyltransferase 2 Beta-14-GalTase 2 beta-4-GalT2 beta4Gal-T2 beta-N-acetylglucosaminyl-glycolipid beta-14-galactosyltransferase 2 EC 2.4.1.- UDP-Gal:betaGlcNAc beta 14- galactosyltransferase 2 UDP-Gal:betaGlcNAc beta 14- galactosyltransferase polypeptide 2 UDP-Gal:betaGlcNAc beta 14-galactosyltransferase polypeptide 2 UDP-Gal:beta-GlcNAc beta-14-galactosyltransferase 2 UDP-galactose:beta-N-acetylglucosamine beta-14-galactosyltransferase 2; Beta-1,4-galactosyltransferase 2; Beta-1,4-GalTase 2; beta-4-GalT2; Beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase; beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase 2; Beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase; Lactose synthase A protein; N-acetyllactosamine synthase; Nal synthase; UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 2; UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase 2; UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2; UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 2; UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 2
Gene Aliases: B4Gal-T2; B4Gal-T3; B4GALT2; beta4Gal-T2
UniProt ID: (Human) O60909
Entrez Gene ID: (Human) 8704
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.