Novus Biologicals
Manufacturer Code:NBP188655
Catalog # NBP188655
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:FRGMSISRPNAVVGRCRMIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQITVDIGTPS |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 14- galactosyltransferase polypeptide 1 B4GAL-T1 beta-14-galactosyltransferase 1 Beta-14-GalTase 1 Beta4Gal-T1 betaGlcNAc beta CDG2D EC 2.4.1 GGTB2DKFZp686N19253 glycoprotein-4-beta-galactosyltransferase 2 GT1 GTB lactose synthase MGC50983 UDP-Gal UDP-Gal:beta-GlcNAc beta-14-galactosyltransferase 1 UDP-galactose:beta-N-acetylglucosamine beta-14-galactosyltransferase 1; Beta-1,4-galactosyltransferase 1; Beta-1,4-GalTase 1; Beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase; Beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase; glycoprotein-4-beta-galactosyltransferase 2; lactose synthase; Lactose synthase A protein; N-acetyllactosamine synthase; Nal synthase; Neolactotriaosylceramide beta-1,4-galactosyltransferase; Processed beta-1,4-galactosyltransferase 1; UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 1; UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 1; UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 1
Gene Aliases: B4GAL-T1; B4GALT1; beta4Gal-T1; CDG2D; GGTB2; GT1; GTB
UniProt ID: (Human) P15291
Entrez Gene ID: (Human) 2683
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.