Novus Biologicals
Manufacturer Code:NBP190228
Catalog # NBP190228
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:KAFQNVLRIQCLRRKQSSKHALGYTLHPPSQAVEGQHKDMVRIPVGSRETFYRISKTDGVCEWKF |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ADRA1Cadrenergic alpha-1A- receptor variant 1 ADRA1L1 adrenergic alpha -1A- receptor adrenergic alpha-1A- receptor adrenergic alpha-1A- receptor variant 3 adrenergic alpha-1A- receptor variant 5 adrenergic alpha-1A- receptor variant 8 adrenergic alpha-1C- receptor alpha-1A adrenergic receptor Alpha-1A adrenoceptor Alpha-1A adrenoreceptor ALPHA1AAR Alpha-1C adrenergic receptor Alpha-adrenergic receptor 1c G protein coupled receptor; adrenergic, alpha-1A-, receptor; Alpha-1A adrenergic receptor; Alpha-1A adrenoceptor; Alpha-1A adrenoreceptor; Alpha-1C adrenergic receptor; Alpha-adrenergic receptor 1c; G protein coupled receptor
Gene Aliases: ADRA1A; ADRA1C; ADRA1L1; ALPHA1AAR
UniProt ID: (Human) P35348
Entrez Gene ID: (Human) 148
Molecular Function:
G-protein coupled receptor
receptor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.