Novus Biologicals
Manufacturer Code:NBP237938
Catalog # NBP237938
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TLQKLPEEIQRDILLEKKKVAQDQLRDKAPFRGLPPVDFVPPIGVESREPADAAIREK |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Alpha-1,2-mannosidase IA; Alpha-12-mannosidase IA EC 3.2.1 EC 3.2.1.113 HUMM3 HUMM9 Man(9)-alpha-mannosidase MAN9 Man9-mannosidase Mannosidase alpha class 1A member 1 mannosidase alpha class 1A member 1 mannosyl-oligosaccharide 12-alpha-mannosidase IA Processing alpha-12-mannosidase IA; Man(9)-alpha-mannosidase; Man9-mannosidase; Mannosidase alpha class 1A member 1; mannosidase, alpha, class 1A, member 1; Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA; Processing alpha-1,2-mannosidase IA
Gene Aliases: HUMM3; HUMM9; MAN1A1; MAN9
UniProt ID: (Human) P33908
Entrez Gene ID: (Human) 4121
Molecular Function: chaperone
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.