Novus Biologicals
Manufacturer Code:NBP190232
Catalog # NBP190232
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:KFEKAMAVGATECISPKDSTKPISEVLSEMTGNNVGYTFEVIGHLETMIDALASCHMNYGTSV |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ADH4 ADH-4 alcohol dehydrogenase 7 (class IV) mu or sigma polypeptide alcohol dehydrogenase class 4 mu/sigma chain Alcohol dehydrogenase class IV mu/sigma chain alcohol dehydrogenase VII alcohol dehydrogenase-7 class IV sigma-1 alcohol dehydrogenase class IV sigmasigma alcohol dehydrogenase EC 1.1.1 EC 1.1.1.1 Gastric alcohol dehydrogenase Retinol dehydrogenase; Alcohol dehydrogenase class 4 mu/sigma chain; Alcohol dehydrogenase class IV mu/sigma chain; alcohol dehydrogenase VII; alcohol dehydrogenase-7; All-trans-retinol dehydrogenase [NAD(+)] ADH7; class IV sigma-1 alcohol dehydrogenase; class IV sigmasigma alcohol dehydrogenase; Gastric alcohol dehydrogenase; Omega-hydroxydecanoate dehydrogenase ADH7; Retinol dehydrogenase
Gene Aliases: ADH4; ADH7
UniProt ID: (Human) P40394
Entrez Gene ID: (Human) 131
Molecular Function: dehydrogenase oxidoreductase reductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.