Novus Biologicals
Manufacturer Code:NBP230636
Catalog # NBP230636
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DYSFECIGNVKVMRAALEACHKGWGVSVVVGVAASGEEIATRPFQLVTGRTWKGTAFG |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ADH-3 ADHXEC 1.1.1.1 alcohol dehydrogenase (class III) chi polypeptide Alcohol dehydrogenase 5 alcohol dehydrogenase 5 (class III) chi polypeptide Alcohol dehydrogenase class chi chain alcohol dehydrogenase class-3 Alcohol dehydrogenase class-III EC 1.1.1 EC 1.1.1.- EC 1.1.1.284 FALDH FDHGSNOR formaldehyde dehydrogenase Glutathione-dependent formaldehyde dehydrogenase GSH-FDH S-(hydroxymethyl)glutathione dehydrogenase; alcohol dehydrogenase (class III), chi polypeptide; Alcohol dehydrogenase 5; Alcohol dehydrogenase class chi chain; Alcohol dehydrogenase class-3; Alcohol dehydrogenase class-III; epididymis secretory sperm binding protein Li 60p; FALDH; formaldehyde dehydrogenase; Glutathione-dependent formaldehyde dehydrogenase; S-(hydroxymethyl)glutathione dehydrogenase
Gene Aliases: ADH-3; ADH5; ADHX; FALDH; FDH; GSH-FDH; GSNOR; HEL-S-60p
UniProt ID: (Human) P11766
Entrez Gene ID: (Human) 128
Molecular Function:
dehydrogenase
oxidoreductase
reductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.