Novus Biologicals
Manufacturer Code:NBP15317320UL
Catalog # NBP15317320
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ADH4(alcohol dehydrogenase 4 (class II) pi polypeptide) The peptide sequence was selected from the middle region of ADH4. Peptide sequence NSEKFVKAKALGATDCLNPRDLHKPIQEVIIELTKGGVDFALDCAGGSET. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ADH-2 alcohol dehydrogenase 4 alcohol dehydrogenase 4 (class II) pi polypeptide Alcohol dehydrogenase class II pi chain aldehyde reductase EC 1.1.1 EC 1.1.1.1; Alcohol dehydrogenase 4; Alcohol dehydrogenase class II pi chain; aldehyde reductase; All-trans-retinol dehydrogenase [NAD(+)] ADH4; epididymis secretory protein Li 4
Gene Aliases: ADH-2; ADH4; HEL-S-4
UniProt ID: (Human) P08319
Entrez Gene ID: (Human) 127
Molecular Function:
dehydrogenase
oxidoreductase
reductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.