Novus Biologicals
Manufacturer Code:NBP179368
Catalog # NBP179368
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the middle region of human ZXDCThe immunogen for this antibody is ZXDC. Peptide sequence NLKAHMKGHEQESLFKCEVCAERFPTHAKLSSHQRSHFEPERPYKCDFPG. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: dJ337O18.5 SWIM domain containing 1 zinc finger SWIM-type containing 1; SERH2790; Zinc finger protein ZXDC; ZXD-like zinc finger protein
Gene Aliases: ZXDC; ZXDL
UniProt ID: (Human) Q2QGD7
Entrez Gene ID: (Human) 79364
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.