Novus Biologicals
Manufacturer Code:NBP156683
Catalog # NBP156683
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ZSWIM3(zinc finger SWIM-type containing 3) The peptide sequence was selected from the N terminal of ZSWIM3. Peptide sequence SVRFHNLNHGTSIREDILYVQVKFVCIRTQSNRKRTREADMCPAYLLLRY. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: human ZW10 interacting protein-1 HZwint-1 KNTC2AP MGC117174 ZW10 interactor ZW10-interacting protein 1 zwint-1 ZWINT1; protein phosphatase 1, regulatory subunit 174; Zinc finger SWIM domain-containing protein 3; zinc finger, SWIM domain containing 3; zinc finger, SWIM-type containing 3
Gene Aliases: C20orf164; PPP1R174; ZSWIM3
UniProt ID: (Human) Q96MP5
Entrez Gene ID: (Human) 140831
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.