Novus Biologicals
Manufacturer Code:NBP19141120UL
Catalog # NBP191420UL
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the C terminal of human hCG_2042202. Peptide sequence HKRIHTGERPFKCKYCSKVFSHKGNLNVHQRTHSGEKPYKCPTCQKAFRQ. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: zinc finger and SCAN domain containing 5B zinc finger and SCAN domain-containing protein 5B ZNF495B; Zinc finger and SCAN domain-containing protein 5B
Gene Aliases: ZNF371; ZNF495B; ZSCAN5B
UniProt ID: (Human) A6NJL1
Entrez Gene ID: (Human) 342933
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.