Novus Biologicals
Manufacturer Code:NBP255227
Catalog # NBP255227
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AVDNEGNPLCLRCQQPTCQTKQACKANSWDSRFCSLKCQEEFWIRSNNSYLRAKVFETEHGVCQLCNVNAQELFLRLRDAPKSQRKNLLYATWT |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: AH2; Annealing helicase 2; DNA annealing helicase and endonuclease ZRANB3; DNA annealing helicase ZRANB3; Endonuclease ZRANB3; MGC105033 MGC750124933425L19Rik zinc finger Ran-binding domain-containing protein 3 zinc finger RAN-binding domain containing 3; Zinc finger Ran-binding domain-containing protein 3; zinc finger, RAN-binding domain containing 3
Gene Aliases: 4933425L19Rik; AH2; ZRANB3
UniProt ID: (Human) Q5FWF4
Entrez Gene ID: (Human) 84083
Molecular Function:
DNA binding protein
DNA helicase
helicase
nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.