Novus Biologicals
Manufacturer Code:NBP186917
Catalog # NBP186917
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:RPSAFDVGYTLVHLAIRFQRQDMLAILLTEVSQQAAKCIPAMVCPELTEQIRREIAASLHQRKGDFACYFLTDLVTFTLPADIEDLP |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: HRPE773 jacalin-like lectin domain containing 2 JCLN2 pancreatic adenocarcinoma upregulated factor PAUF PRO1567 zymogen granule protein 16 homolog B zymogen granule protein 16 homolog B (rat); hTrabid; TRAF-binding domain-containing protein; TRAF-binding protein domain; Ubiquitin thioesterase ZRANB1; Zinc finger Ran-binding domain-containing protein 1; zinc finger, RAN-binding domain containing 1
Gene Aliases: TRABID; ZRANB1
UniProt ID: (Human) Q9UGI0
Entrez Gene ID: (Human) 54764
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.