Novus Biologicals
Manufacturer Code:NBP15943620UL
Catalog # NBP15943620
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ZP2(zona pellucida glycoprotein 2 (sperm receptor)) The peptide sequence was selected from the C terminal of ZP2. Peptide sequence PDSFPQWNVVVDGCAYDLDNYQTTFHPVGSSVTHPDHYQRFDMKAFAFVS. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Processed zona pellucida sperm-binding protein 2; Zona pellucida glycoprotein 2; zona pellucida glycoprotein 2 (sperm receptor); Zona pellucida glycoprotein 2 zona pellucida glycoprotein 2 (sperm receptor) zona pellucida glycoprotein ZP2 Zona pellucida protein A zona pellucida sperm-binding protein 2 Zp-2; zona pellucida glycoprotein ZP2; Zona pellucida protein A; Zona pellucida sperm-binding protein 2; Zp-2
Gene Aliases: Zp-2; ZP2; ZPA
UniProt ID: (Human) Q05996
Entrez Gene ID: (Human) 7783
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.