Novus Biologicals
Manufacturer Code:NBP185673
Catalog # NBP185673
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:TSVRSQDPGQRRVLDRAARQRRINRQLEALENDNFQDDPHAGLPQLGKRLPQFDDDADTGKK |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CG1I CGBP1 Cyclin-G1-binding protein 1 H_DJ0747G18.14 p18 Hamlet p18Hamlet putative cyclin G1 interacting protein zinc finger HIT domain-containing protein 1 Zinc finger protein subfamily 4A member 1 zinc finger protein subfamily 4A (HIT domain containing) member 1 zinc finger HIT domain containing 1 zinc finger HIT type 1 zinc finger HIT-type containing 1 ZNFN4A1; Cyclin-G1-binding protein 1; H_DJ0747G18.14; p18 Hamlet; p18Hamlet; putative cyclin G1 interacting protein; Zinc finger HIT domain-containing protein 1; Zinc finger protein subfamily 4A member 1; zinc finger protein, subfamily 4A (HIT domain containing), member 1; zinc finger, HIT domain containing 1; zinc finger, HIT type 1; zinc finger, HIT-type containing 1
Gene Aliases: CG1I; CGBP1; ZNFN4A1; ZNHIT1
UniProt ID: (Human) O43257
Entrez Gene ID: (Human) 10467
Molecular Function:
transcription factor
zinc finger transcription factor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.