Novus Biologicals
Manufacturer Code:NBP169105
Catalog # NBP169105
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ZER1 (zer-1 homolog (C. elegans)) The peptide sequence was selected from the middle region of ZER1. Peptide sequence LTNSEYRSEQSVKLRRQVIQVVLNGMESYQEVTVQRNCCLTLCNFSIPEE. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: C9orf60 chromosome 9 open reading frame 60 homolog of Zyg-11 Hzygzyg-11 homolog B (C. elegans)-like protein zer-1 homolog zer-1 homolog (C. elegans) ZYG homolog Zyg-11 homolog B-like protein ZYG11BL ZYGRP11-545E17.4; Hzyg; Protein zer-1 homolog; zer-1 homolog; ZYG homolog; Zyg-11 homolog B-like protein; zyg-11 related, cell cycle regulator; Zyg11b-like protein
Gene Aliases: C9orf60; ZER1; ZYG; ZYG11BL
UniProt ID: (Human) Q7Z7L7
Entrez Gene ID: (Human) 10444
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.