Novus Biologicals
Manufacturer Code:NBP256799
Catalog # NBP256799
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LKSENPTWERRLRWEGMKSVFGGPPSLLWMNPFVGFRFRRLPTRPRKGGPEFS |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Acyltransferase ZDHHC7; DHHC-7; EC 2.3.1 EC 2.3.1.- FLJ10792 FLJ20279 palmitoyltransferase ZDHHC7 Sertoli cell gene with zinc finger domain- and #946 SERZ1 SERZ-B Zinc finger DHHC domain-containing protein 7 Zinc finger protein 370 zinc finger DHHC domain containing 7 zinc finger DHHC-type containing 7 ZNF370DHHC-7; Palmitoyltransferase ZDHHC7; Sertoli cell gene with zinc finger domain-β Zinc finger DHHC domain-containing protein 7; zinc finger protein 370; zinc finger, DHHC domain containing 7; zinc finger, DHHC-type containing 7
Gene Aliases: DHHC7; SERZ-B; SERZ1; ZDHHC7; ZNF370
UniProt ID: (Human) Q9NXF8
Entrez Gene ID: (Human) 55625
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.