Novus Biologicals
Manufacturer Code:NBP182132
Catalog # NBP182132
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:QLYHRLSFGWNTVKIDMSAARRDPLPIVPFGLAAF |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DHHC-6; DHHC-6 EC 2.3.1 EC 2.3.1.- FLJ21952 Transmembrane protein H4 Zinc finger DHHC domain-containing protein 6 Zinc finger protein 376 zinc finger DHHC domain containing 6 zinc finger DHHC-type containing 6 ZNF376probable palmitoyltransferase ZDHHC6; Palmitoyltransferase ZDHHC6; Stearoyltransferase ZDHHC6; Transmembrane protein H4; Zinc finger DHHC domain-containing protein 6; Zinc finger protein 376; zinc finger, DHHC-type containing 6
Gene Aliases: DHHC-6; ZDHHC6; ZNF376
UniProt ID: (Human) Q9H6R6
Entrez Gene ID: (Human) 64429
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.