Novus Biologicals
Manufacturer Code:NBP15704920UL
Catalog # NBP15704920
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ZDHHC21 (zinc finger DHHC-type containing 21) The peptide sequence was selected from the middle region of ZDHHC21. Peptide sequence ELLTCYALMFSFCHYYYFLPLKKRNLDLFVFRHELAIMRLAAFMGITMLV. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DHHC domain-containing cysteine-rich protein 21; DHHC-21; DHHC-21 DNZ1 EC 2.3.1 EC 2.3.1.- HSPC097 probable palmitoyltransferase ZDHHC21 Zinc finger DHHC domain-containing protein 21 zinc finger DHHC domain containing 21 zinc finger DHHC-type containing 219130404H11Rik; Palmitoyltransferase ZDHHC21; probable palmitoyltransferase ZDHHC21; Zinc finger DHHC domain-containing protein 21; zinc finger, DHHC domain containing 21; zinc finger, DHHC-type containing 21
Gene Aliases: 9130404H11Rik; DHHC-21; DHHC21; DNZ1; HSPC097; ZDHHC21
UniProt ID: (Human) Q8IVQ6
Entrez Gene ID: (Human) 340481
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.