Novus Biologicals
Manufacturer Code:NBP213541
Catalog # NBP213541
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KEFHLSYAEKDLLEREPRGEAHQEVLRRAAKDLPIYTRTMSGAIRYCDRC QLI |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Acyltransferase ZDHHC2; DHHC-2; DHHC2 DHHC-2 EC 2.3.1 EC 2.3.1.- palmitoyltransferase ZDHHC2 Ream REC Reduced expression associated with metastasis protein Reduced expression in cancer protein Zinc finger DHHC domain-containing protein 2 Zinc finger protein 372 zinc finger DHHC domain containing 2 zinc finger DHHC-type containing 2 ZNF372rec; Palmitoyltransferase ZDHHC2; Ream; Rec; Reduced expression associated with metastasis protein; Reduced expression in cancer protein; testis tissue sperm-binding protein Li 56e; Zinc finger DHHC domain-containing protein 2; Zinc finger protein 372; zinc finger, DHHC domain containing 2; zinc finger, DHHC-type containing 2
Gene Aliases: DHHC2; REAM; REC; ZDHHC2; ZNF372
UniProt ID: (Human) Q9UIJ5
Entrez Gene ID: (Human) 51201
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.