Novus Biologicals
Manufacturer Code:NBP181748
Catalog # NBP181748
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:RKEGFNTKMADGPDEYDTEAGCVPLLHPEEIKPQSHYNHGYGEPLGRKTHIDDYSTWDIVKATQYGIYERCRELVEAGYDVR |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Acyltransferase ZDHHC17; DHHC domain-containing cysteine-rich protein 17; DHHC-17; DHHC-17 EC 2.3.1 EC 2.3.1.- HIP14HIP-14 huntingtin interacting protein 14 huntingtin interacting protein 3 Huntingtin interacting protein H Huntingtin yeast partner H Huntingtin-interacting protein 14 Huntingtin-interacting protein 3 Huntingtin-interacting protein H HYPHHIP-3 KIAA0946HIP3 palmitoyltransferase ZDHHC17 Putative MAPK-activating protein PM11 Putative NF-kappa-B-activating protein 205 Zinc finger DHHC domain-containing protein 17 zinc finger DHHC domain containing 17 zinc finger DHHC-type containing 17; DHHC17; HIP-14; HIP-3; huntingtin interacting protein 14; huntingtin interacting protein 3; Huntingtin interacting protein H; Huntingtin yeast partner H; Huntingtin-interacting protein 14; Huntingtin-interacting protein 3; Huntingtin-interacting protein H; Palmitoyltransferase ZDHHC17; Putative MAPK-activating protein PM11; Putative NF-kappa-B-activating protein 205; Zinc finger DHHC domain-containing protein 17; zinc finger, DHHC domain containing 17; zinc finger, DHHC-type containing 17
Gene Aliases: HIP14; HIP3; HSPC294; HYPH; KIAA0946; ZDHHC17
UniProt ID: (Human) Q8IUH5
Entrez Gene ID: (Human) 23390
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.