Novus Biologicals
Manufacturer Code:NBP160110
Catalog # NBP160110
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ZDHHC14(zinc finger DHHC-type containing 14) The peptide sequence was selected from the N terminal of ZDHHC14. Peptide sequence TLLRTSFSDPGVLPRATPDEAADLERQIDIANGTSSGGYRPPPRTKEVII. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DHHC domain containing 14 DHHC-14 EC 2.3.1 EC 2.3.1.- NEW1 domain-containing protein zinc finger DHHC-type containing 14; DHHC domain-containing cysteine-rich protein 14; DHHC-14; NEW1 domain containing protein; NEW1 domain-containing protein; NEW1CP; Palmitoyltransferase ZDHHC14; Zinc finger DHHC domain-containing protein 14; zinc finger, DHHC domain containing 14; zinc finger, DHHC-type containing 14
Gene Aliases: NEW1CP; ZDHHC14
UniProt ID: (Human) Q8IZN3
Entrez Gene ID: (Human) 79683
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.