Novus Biologicals
Manufacturer Code:NBP15902620UL
Catalog # NBP15902620
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ZDHHC13(zinc finger DHHC-type containing 13) The peptide sequence was selected from the N terminal of ZDHHC13. Peptide sequence MVILLLQHGADPTLIDGEGFSSIHLAVLFQHMPIIAYLISKGQSVNMTDV. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DHHC-13; DHHC-13 EC 2.3.1 EC 2.3.1.- FLJ10852 FLJ10941 HIP14LHIP14-related protein HIP3RP huntingtin interacting protein HIP3RP Huntingtin-interacting protein 14-related protein Huntingtin-interacting protein HIP3RP MGC64994 palmitoyltransferase ZDHHC13 probable palmitoyltransferase ZDHHC13 Putative MAPK-activating protein PM03 Putative NF-kappa-B-activating protein 209 Zinc finger DHHC domain-containing protein 13 zinc finger DHHC domain containing 13 zinc finger DHHC-type containing 13; HIP14-related protein; huntingtin interacting protein HIP3RP; Huntingtin-interacting protein 14-related protein; Huntingtin-interacting protein HIP3RP; Palmitoyltransferase ZDHHC13; probable palmitoyltransferase ZDHHC13; Putative MAPK-activating protein PM03; Putative NF-kappa-B-activating protein 209; Zinc finger DHHC domain-containing protein 13; zinc finger, DHHC domain containing 13; zinc finger, DHHC-type containing 13
Gene Aliases: HIP14L; HIP3RP; ZDHHC13
UniProt ID: (Human) Q8IUH4
Entrez Gene ID: (Human) 54503
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.