Novus Biologicals
Manufacturer Code:NBP213540
Catalog # NBP213540
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DPADANVRDKSYAGPLPIFNRSQHAHVIEDLHCNLCNVDVSARSKHCS |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: C16orf1 DHHC domain-containing cysteine-rich protein 1 DHHC-1 DHHC-domain-containing cysteine-rich protein EC 2.3.1.- HSU90653 probable palmitoyltransferase ZDHHC1 Zinc finger DHHC domain-containing protein 1 Zinc finger protein 377 zinc finger DHHC domain containing 1 zinc finger DHHC-type containing 1 ZNF377chromosome 16 open reading frame 1; DHHC domain-containing cysteine-rich protein 1; DHHC-1; DHHC-domain-containing cysteine-rich protein; Palmitoyltransferase ZDHHC1; Zinc finger DHHC domain-containing protein 1; Zinc finger protein 377; zinc finger, DHHC domain containing 1; zinc finger, DHHC-type containing 1
Gene Aliases: C16orf1; HSU90653; ZDHHC1; ZNF377
UniProt ID: (Human) Q8WTX9
Entrez Gene ID: (Human) 29800
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.