Novus Biologicals
Manufacturer Code:NBP15677720UL
Catalog # NBP15677720
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ZCCHC14(zinc finger CCHC domain containing 14) The peptide sequence was selected from the N terminal of ZCCHC14. Peptide sequence RYLASLPSHVLKNDHVRRFLSTSSPPQQLQSPSPGNPSLSKVGTVMGVSG. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: BDG-29; BDG29 BDG-29 KIAA0579 MGC126527 MGC14139 zinc finger CCHC domain-containing protein 14 zinc finger CCHC domain containing 14; Zinc finger CCHC domain-containing protein 14; zinc finger, CCHC domain containing 14
Gene Aliases: BDG-29; BDG29; KIAA0579; ZCCHC14
UniProt ID: (Human) Q8WYQ9
Entrez Gene ID: (Human) 23174
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.