Novus Biologicals
Manufacturer Code:NBP188375
Catalog # NBP188375
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:TFIKSSLDISEKEKDRYFSLSDKDANSNGVERSSFYSGGWQEGSSSPRSHLSPEQGTGIISGKSWNKYNYHPASQKNTQQP |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: BOZ-F1; BOZ-F1 BOZF1BTB/POZ and zinc-finger domains factor on chromosome 1 BTB/POZ and zinc-finger domain-containing factor FLJ90065 MGC17919 ZBTB8 zinc finger and BTB domain containing 8 zinc finger and BTB domain containing 8A zinc finger and BTB domain-containing protein 8A ZNF916A; BTB/POZ and zinc-finger domain-containing factor; BTB/POZ and zinc-finger domains factor on chromosome 1; zinc finger and BTB domain containing 8; Zinc finger and BTB domain-containing protein 8A
Gene Aliases: BOZF1; ZBTB8; ZBTB8A; ZNF916A
UniProt ID: (Human) Q96BR9
Entrez Gene ID: (Human) 653121
Molecular Function:
actin family cytoskeletal protein
cytoskeletal protein
hydrolase
non-motor actin binding protein
protease
serine protease
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.