Novus Biologicals
Manufacturer Code:NBP18011320UL
Catalog # NB8011320UL
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the C terminal of human ZBTB22. Peptide sequence MQGNQILVFPSSSSSSSSQAPGQPPGNQAEHGAVTVGGTSVGSLGVPGSV. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: BING1ZNF297 fru fruitless Protein BING1 ZBTB22AZNF297A zinc finger and BTB domain containing 22 zinc finger and BTB domain-containing protein 22 Zinc finger protein 297Zinc finger and BTB domain-containing protein 22A; Protein BING1; Zinc finger and BTB domain-containing protein 22; Zinc finger and BTB domain-containing protein 22A; Zinc finger protein 297
Gene Aliases: BING1; fru; fruitless; ZBTB22; ZBTB22A; ZNF297; ZNF297A
UniProt ID: (Human) O15209
Entrez Gene ID: (Human) 9278
Molecular Function:
actin family cytoskeletal protein
cytoskeletal protein
hydrolase
non-motor actin binding protein
protease
serine protease
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.