Novus Biologicals
Manufacturer Code:NBP257846
Catalog # NBP257846
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DMKFEYLLYGHHREQIACQACGKTFSDEGRLRKHEKLHTADRPCVCEMCTKGFTTQAHLKEH |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ZF5; Zfp-161; ZFP161 zinc finger protein; Zinc finger and BTB domain-containing protein 14; Zinc finger protein 161 homolog; Zinc finger protein 478; Zinc finger protein 5 homolog; zinc finger protein homologous to Zfp161 in mouse
Gene Aliases: ZBTB14; ZF5; ZFP-161; ZFP-5; ZFP161; ZNF478
UniProt ID: (Human) O43829
Entrez Gene ID: (Human) 7541
Molecular Function:
DNA binding protein
centromere DNA-binding protein
nucleic acid binding
transcription factor
zinc finger transcription factor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.