Novus Biologicals
Manufacturer Code:NBP258340
Catalog # NBP258340
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RNRGSGFGHNGVDGNGVGQSQAGSGSTPSEPHPVLEKLRSINNY |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 9430020E02Rik; CLL-associated antigen KW-14; CLL-associated antigen KW-14 HGRG8YTH domain family 2 High-glucose-regulated protein 8 NY-REN-29430020E02Rik Renal carcinoma antigen NY-REN-2 YTH domain family protein 2 YTH domain family member 2; DF2; High-glucose-regulated protein 8; Renal carcinoma antigen NY-REN-2; YTH domain family, member 2; YTH domain-containing family protein 2; YTH N(6)-methyladenosine RNA binding protein 2
Gene Aliases: CAHL; HGRG8; NY-REN-2; YTHDF2
UniProt ID: (Human) B4E1G7
Entrez Gene ID: (Human) 51441
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.