Novus Biologicals
Manufacturer Code:NBP182072
Catalog # NBP182072
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:ASSLNVEEFQDLWPQLSLVIDGGQIGDGQSPECRLGSTVVDLSVPGKFGIIRPGCALESTTAILQQKYGLLP |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: dopamine receptor interacting protein 3; dopamine receptor interacting protein 3 Dopamine receptor-interacting protein 3 DRIP3 FLJ23476 FLJ26165 hIRIP IRIPyrdC domain containing (E.coli) ischemia/reperfusion inducible protein Ischemia/reperfusion-inducible protein homolog RP11-109P14.4 SUA5 yrdC domain containing (E. coli) yrdC domain-containing protein mitochondrial; Dopamine receptor-interacting protein 3; hIRIP; ischemia/reperfusion inducible protein; Ischemia/reperfusion-inducible protein homolog; yrdC domain containing; YrdC domain-containing protein, mitochondrial; yrdC N(6)-threonylcarbamoyltransferase domain containing
Gene Aliases: DRIP3; IRIP; SUA5; YRDC
UniProt ID: (Human) Q86U90
Entrez Gene ID: (Human) 79693
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.