Novus Biologicals
Manufacturer Code:NBP189362
Catalog # NBP189362
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:ALMYFIVRSLRTAALGPDSMGGPVPRQRLQ |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 54TMp; 54TMp 54TMYIF1protein YIF1A FinGER7 HYIF1P putative Rab5-interacting protein putative transmembrane protein 54TMp YIF1P Yip1 interacting factor homolog (S. cerevisiae) Yip1 interacting factor homolog A (S. cerevisiae) YIP1-interacting factor homolog A Yip1p-interacting factor; Protein YIF1A; putative Rab5-interacting protein; putative transmembrane protein 54TMp; Yip1 interacting factor homolog A; YIP1-interacting factor homolog A; Yip1p-interacting factor
Gene Aliases: 54TM; FinGER7; HYIF1P; YIF1; YIF1A; YIF1P
UniProt ID: (Human) O95070
Entrez Gene ID: (Human) 10897
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.