Novus Biologicals
Manufacturer Code:NBP256297
Catalog # NBP256297
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DALEVMSDQELKELFKEAPFSEFFLDPGTSVLDTCRKANAIPDGPRGYRMITEGGVSINHQQVTNPESVLIVGQHILKNGLSL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CGI-04 EC 6.1.1.1 FLJ13995 MLASA2 MT-TYRRS tyrosine tRNA ligase 2 mitochondrial Tyrosine--tRNA ligase tyrosyl-tRNA synthetase 2 mitochondrial tyrosyl-tRNA synthetase mitochondrial TYRRS; tyrosine tRNA ligase 2, mitochondrial; Tyrosine--tRNA ligase, mitochondrial; Tyrosyl-tRNA synthetase; tyrosyl-tRNA synthetase 2, mitochondrial; TyrRS
Gene Aliases: CGI-04; MLASA2; MT-TYRRS; TYRRS; YARS2
UniProt ID: (Human) Q9Y2Z4
Entrez Gene ID: (Human) 51067
Molecular Function:
aminoacyl-tRNA synthetase
ligase
nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.