Novus Biologicals
Manufacturer Code:NBP238430
Catalog # NBP238430
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This YAP1 antibody was developed against a recombinant protein corresponding to amino acids: PRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLD |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 65 kDa Yes-associated protein; 65 kDa Yes-associated protein COB1 Protein Yorkie Homolog Transcriptional Coactivator YAP1 YAP YAP1-2gamma YAP2 YAP2L YAP65 YAP65yes-associated protein 2 Yes Associated Protein Yes-Associated Protein Yes-associated protein 1 Yes-associated protein 1 65kDa yes-associated protein beta yes-associated protein delta Yes-Associated Protein YAP65 Homolog YKI yorkie homolog; Protein yorkie homolog; Transcriptional coactivator YAP1; Yes-associated protein 1; yes-associated protein 2; Yes-associated protein YAP65 homolog; yorkie homolog
Gene Aliases: COB1; YAP; YAP1; YAP2; YAP65; YKI
UniProt ID: (Human) P46937
Entrez Gene ID: (Human) 10413
Molecular Function:
enzyme modulator
kinase modulator
transcription cofactor
transcription factor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.